SCOPe 2.06: Domain d5hggt_: 5hgg T:

Lineage for d5hggt_ (5hgg T:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries)

8. Domain d5hggt_: 5hgg T: [317980]
   Other proteins in same PDB: d5hgga_, d5hggb_
   automated match to d2vyrh_
   complexed with gol, mes, so4, twn

Details for d5hggt_

PDB Entry: 5hgg, 1.97 Å

PDB Description: crystal structure of upa in complex with a camelid-derived antibody fragment

PDB Compounds: (T:) Camelid Derived Antibody Fragment, Nb4

SCOPe Domain Sequences for d5hggt_:

Sequence; same for both SEQRES and ATOM records:

>d5hggt_ b.1.1.1 (T:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
tqvtvss

Timeline for d5hggt_:

• d5hggt_ is new in SCOPe 2.06-stable
  
• d5hggt_ is called d5hggt1 in SCOPe 2.07
  
• d5hggt_ appears in the current release, SCOPe 2.08, called d5hggt1