![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) ![]() both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules |
![]() | Family c.36.1.1: Pyruvate oxidase and decarboxylase THDP-binding domains [52519] (4 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Pyruvate oxidase [52524] (1 species) |
![]() | Species Lactobacillus plantarum [TaxId:1590] [52525] (2 PDB entries) |
![]() | Domain d1powa3: 1pow A:366-593 [31798] Other proteins in same PDB: d1powa1, d1powb1 |
PDB Entry: 1pow (more details), 2.5 Å
SCOP Domain Sequences for d1powa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1powa3 c.36.1.1 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum} kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqe dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
Timeline for d1powa3: