SCOP 1.59: Domain d1powa3: 1pow A:366-593

Lineage for d1powa3 (1pow A:366-593)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families)

5. Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (4 proteins)

6. Protein Pyruvate oxidase [52524] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [52525] (2 PDB entries)

8. Domain d1powa3: 1pow A:366-593 [31798]
   Other proteins in same PDB: d1powa1, d1powb1

Details for d1powa3

PDB Entry: 1pow, 2.5 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum

SCOP Domain Sequences for d1powa3:

Sequence; same for both SEQRES and ATOM records:

>d1powa3 c.36.1.1 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd

Timeline for d1powa3:

• d1powa3 first appeared (with stable ids) in SCOP 1.55
  
• d1powa3 appears in SCOP 1.57
  
• d1powa3 appears in SCOP 1.61
  
• d1powa3 appears in the current release, SCOPe 2.08