Lineage for d1powa3 (1pow A:366-593)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69360Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 69361Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 69362Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (3 proteins)
  6. 69391Protein Pyruvate oxidase [52524] (1 species)
  7. 69392Species Lactobacillus plantarum [TaxId:1590] [52525] (2 PDB entries)
  8. 69398Domain d1powa3: 1pow A:366-593 [31798]
    Other proteins in same PDB: d1powa1, d1powb1

Details for d1powa3

PDB Entry: 1pow (more details), 2.5 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum

SCOP Domain Sequences for d1powa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1powa3 c.36.1.1 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd

SCOP Domain Coordinates for d1powa3:

Click to download the PDB-style file with coordinates for d1powa3.
(The format of our PDB-style files is described here.)

Timeline for d1powa3: