SCOPe 2.07: Domain d5hmmb2: 5hmm B:186-290

Lineage for d5hmmb2 (5hmm B:186-290)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein T5 5'-exonuclease [47813] (1 species)

7. Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries)

8. Domain d5hmmb2: 5hmm B:186-290 [317978]
   Other proteins in same PDB: d5hmma1, d5hmmb1
   automated match to d1xo1a1
   complexed with cl, edo, mg

Details for d5hmmb2

PDB Entry: 5hmm, 1.5 Å

PDB Description: crystal structure of t5 d15 protein co-crystallized with metal ions

PDB Compounds: (B:) exodeoxyribonuclease

SCOPe Domain Sequences for d5hmmb2:

Sequence; same for both SEQRES and ATOM records:

>d5hmmb2 a.60.7.1 (B:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiae

Timeline for d5hmmb2:

• d5hmmb2 first appeared in SCOPe 2.06
  
• d5hmmb2 appears in the current release, SCOPe 2.08