Lineage for d5hmmb2 (5hmm B:186-290)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001760Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2001761Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 2001794Protein T5 5'-exonuclease [47813] (1 species)
  7. 2001795Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries)
  8. 2001799Domain d5hmmb2: 5hmm B:186-290 [317978]
    Other proteins in same PDB: d5hmma1, d5hmmb1
    automated match to d1xo1a1
    complexed with cl, edo, mg

Details for d5hmmb2

PDB Entry: 5hmm (more details), 1.5 Å

PDB Description: crystal structure of t5 d15 protein co-crystallized with metal ions
PDB Compounds: (B:) exodeoxyribonuclease

SCOPe Domain Sequences for d5hmmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmmb2 a.60.7.1 (B:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiae

SCOPe Domain Coordinates for d5hmmb2:

Click to download the PDB-style file with coordinates for d5hmmb2.
(The format of our PDB-style files is described here.)

Timeline for d5hmmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hmmb1