Lineage for d5hmmb1 (5hmm B:20-185)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169006Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2169007Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2169068Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 2169101Protein T5 5'-exonuclease [53050] (1 species)
  7. 2169102Species Bacteriophage T5 [TaxId:10726] [53051] (6 PDB entries)
  8. 2169106Domain d5hmmb1: 5hmm B:20-185 [317977]
    Other proteins in same PDB: d5hmma2, d5hmmb2
    automated match to d1exna2
    complexed with cl, edo, mg

Details for d5hmmb1

PDB Entry: 5hmm (more details), 1.5 Å

PDB Description: crystal structure of t5 d15 protein co-crystallized with metal ions
PDB Compounds: (B:) exodeoxyribonuclease

SCOPe Domain Sequences for d5hmmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmmb1 c.120.1.2 (B:20-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhn

SCOPe Domain Coordinates for d5hmmb1:

Click to download the PDB-style file with coordinates for d5hmmb1.
(The format of our PDB-style files is described here.)

Timeline for d5hmmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hmmb2