SCOPe 2.08: Domain d5hysl1: 5hys L:1-110

Lineage for d5hysl1 (5hys L:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5hysl1: 5hys L:1-110 [317969]
   Other proteins in same PDB: d5hysa_, d5hysb2, d5hysc_, d5hysd2, d5hyse_, d5hysf2, d5hysg1, d5hysg2, d5hysh_, d5hysi1, d5hysi2, d5hysj1, d5hysj2, d5hysk1, d5hysk2, d5hysl2
   automated match to d1dn0a1
   complexed with so4

Details for d5hysl1

PDB Entry: 5hys, 2.5 Å

PDB Description: structure of ige complexed with omalizumab

PDB Compounds: (L:) Uncharacterized protein

SCOPe Domain Sequences for d5hysl1:

Sequence; same for both SEQRES and ATOM records:

>d5hysl1 b.1.1.0 (L:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsslsasvgdrvtitcrasqsvdydgdsymnwyqqkpgkapklliyaasyles
gvpsrfsgsgsgtdftltisslqpedfatyycqqshedpytfgqgtkvei

Timeline for d5hysl1:

• d5hysl1 first appeared in SCOPe 2.06
  
• d5hysl1 appears in SCOPe 2.07