Lineage for d5hmla1 (5hml A:20-185)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529111Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2529112Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2529173Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 2529206Protein T5 5'-exonuclease [53050] (1 species)
  7. 2529207Species Bacteriophage T5 [TaxId:10726] [53051] (6 PDB entries)
  8. 2529208Domain d5hmla1: 5hml A:20-185 [317967]
    Other proteins in same PDB: d5hmla2, d5hmlb2
    automated match to d1exna2
    complexed with b3p, cl, edo, iod, mg

Details for d5hmla1

PDB Entry: 5hml (more details), 1.48 Å

PDB Description: crystal structure of t5 d15 protein co-crystallized with metal ions
PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d5hmla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmla1 c.120.1.2 (A:20-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
ighlydhvwlistkgdwdtlltdkvsrfsfttrreyhlrdmyehhn

SCOPe Domain Coordinates for d5hmla1:

Click to download the PDB-style file with coordinates for d5hmla1.
(The format of our PDB-style files is described here.)

Timeline for d5hmla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hmla2