Lineage for d5hdod_ (5hdo D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742101Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2742147Domain d5hdod_: 5hdo D: [317959]
    Other proteins in same PDB: d5hdoc2
    automated match to d2vyrh_
    complexed with cl, so4

Details for d5hdod_

PDB Entry: 5hdo (more details), 2.16 Å

PDB Description: crystal structure of a nanobody raised against urokinase-type plasminogen activator
PDB Compounds: (D:) Anti-HCV NS3/4A serine protease immoglobulin heavy chain

SCOPe Domain Sequences for d5hdod_:

Sequence, based on SEQRES records: (download)

>d5hdod_ b.1.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
tqvtvss

Sequence, based on observed residues (ATOM records): (download)

>d5hdod_ b.1.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsrrrylevwgqgtqv
tvss

SCOPe Domain Coordinates for d5hdod_:

Click to download the PDB-style file with coordinates for d5hdod_.
(The format of our PDB-style files is described here.)

Timeline for d5hdod_: