Lineage for d1poxa3 (1pox A:366-593)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22854Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 22855Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 22856Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (3 proteins)
  6. 22885Protein Pyruvate oxidase [52524] (1 species)
  7. 22886Species Lactobacillus plantarum [TaxId:1590] [52525] (2 PDB entries)
  8. 22888Domain d1poxa3: 1pox A:366-593 [31794]
    Other proteins in same PDB: d1poxa1, d1poxb1

Details for d1poxa3

PDB Entry: 1pox (more details), 2.1 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum

SCOP Domain Sequences for d1poxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poxa3 c.36.1.1 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlvtqvqyhlpvinvvftncqygfikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd

SCOP Domain Coordinates for d1poxa3:

Click to download the PDB-style file with coordinates for d1poxa3.
(The format of our PDB-style files is described here.)

Timeline for d1poxa3: