Lineage for d5ev6c_ (5ev6 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2603069Protein automated matches [190079] (12 species)
    not a true protein
  7. 2603266Species Serratia marcescens [TaxId:615] [186800] (8 PDB entries)
  8. 2603277Domain d5ev6c_: 5ev6 C: [317923]
    Other proteins in same PDB: d5ev6b2
    automated match to d1jjeb_
    complexed with act, edo, zn

Details for d5ev6c_

PDB Entry: 5ev6 (more details), 1.98 Å

PDB Description: crystal structure of the native, di-zinc metallo-beta-lactamase imp-1
PDB Compounds: (C:) beta-lactamase imp-1

SCOPe Domain Sequences for d5ev6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ev6c_ d.157.1.1 (C:) automated matches {Serratia marcescens [TaxId: 615]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglneskkpsk

SCOPe Domain Coordinates for d5ev6c_:

Click to download the PDB-style file with coordinates for d5ev6c_.
(The format of our PDB-style files is described here.)

Timeline for d5ev6c_: