Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (12 species) not a true protein |
Species Serratia marcescens [TaxId:615] [186800] (8 PDB entries) |
Domain d5ev6c_: 5ev6 C: [317923] Other proteins in same PDB: d5ev6b2 automated match to d1jjeb_ complexed with act, edo, zn |
PDB Entry: 5ev6 (more details), 1.98 Å
SCOPe Domain Sequences for d5ev6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ev6c_ d.157.1.1 (C:) automated matches {Serratia marcescens [TaxId: 615]} lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll kskygkaklvvpshsevgdasllkltleqavkglneskkpsk
Timeline for d5ev6c_:
View in 3D Domains from other chains: (mouse over for more information) d5ev6a_, d5ev6b1, d5ev6b2, d5ev6d_ |