Lineage for d1zpdf2 (1zpd F:2-187)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22854Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 22855Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 22856Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (3 proteins)
  6. 22861Protein Pyruvate decarboxylase [52520] (3 species)
  7. 22876Species Zymomonas mobilis [TaxId:542] [52523] (1 PDB entry)
  8. 22883Domain d1zpdf2: 1zpd F:2-187 [31791]
    Other proteins in same PDB: d1zpda1, d1zpdb1, d1zpde1, d1zpdf1

Details for d1zpdf2

PDB Entry: 1zpd (more details), 1.86 Å

PDB Description: pyruvate decarboxylase from zymomonas mobilis

SCOP Domain Sequences for d1zpdf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpdf2 c.36.1.1 (F:2-187) Pyruvate decarboxylase {Zymomonas mobilis}
sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
salfnd

SCOP Domain Coordinates for d1zpdf2:

Click to download the PDB-style file with coordinates for d1zpdf2.
(The format of our PDB-style files is described here.)

Timeline for d1zpdf2: