SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1zpdf2 (1zpd F:2-187)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108260Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 protein domains)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 2108366Protein Pyruvate decarboxylase [88725] (3 species)
  7. 2108375Species Zymomonas mobilis [TaxId:542] [88728] (1 PDB entry)
  8. 2108379Domain d1zpdf2: 1zpd F:2-187 [31791]
    Other proteins in same PDB: d1zpda1, d1zpda3, d1zpdb1, d1zpdb3, d1zpde1, d1zpde3, d1zpdf1, d1zpdf3
    complexed with cit, dpx, mg

Details for d1zpdf2

PDB Entry: 1zpd (more details), 1.86 Å

PDB Description: pyruvate decarboxylase from zymomonas mobilis
PDB Compounds: (F:) pyruvate decarboxylase

SCOPe Domain Sequences for d1zpdf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpdf2 c.36.1.5 (F:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]}
sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
salfnd

SCOPe Domain Coordinates for d1zpdf2:

Click to download the PDB-style file with coordinates for d1zpdf2.
(The format of our PDB-style files is described here.)

Timeline for d1zpdf2: