Lineage for d5hlqa_ (5hlq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2301126Protein Myoglobin [46469] (10 species)
  7. 2301271Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (278 PDB entries)
    Uniprot P02185
  8. 2301447Domain d5hlqa_: 5hlq A: [317889]
    automated match to d4pqca_
    complexed with hem

Details for d5hlqa_

PDB Entry: 5hlq (more details), 1.5 Å

PDB Description: x-ray crystal structure of met f43h/h64a sperm whale myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5hlqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hlqa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekhdrfkhlkteaemkasedl
kkagvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpg
dfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d5hlqa_:

Click to download the PDB-style file with coordinates for d5hlqa_.
(The format of our PDB-style files is described here.)

Timeline for d5hlqa_: