SCOPe 2.06: Domain d5fk9c2: 5fk9 C:121-233

Lineage for d5fk9c2 (5fk9 C:121-233)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein automated matches [226944] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225595] (3 PDB entries)

8. Domain d5fk9c2: 5fk9 C:121-233 [317887]
   Other proteins in same PDB: d5fk9a1, d5fk9a2, d5fk9b1, d5fk9b2, d5fk9c1
   automated match to d1esfa2
   mutant

Details for d5fk9c2

PDB Entry: 5fk9, 3.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor

PDB Compounds: (C:) enterotoxin type a

SCOPe Domain Sequences for d5fk9c2:

Sequence; same for both SEQRES and ATOM records:

>d5fk9c2 d.15.6.1 (C:121-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

Timeline for d5fk9c2:

• d5fk9c2 is new in SCOPe 2.06-stable
  
• d5fk9c2 appears in SCOPe 2.07
  
• d5fk9c2 appears in the current release, SCOPe 2.08