Lineage for d5fk9c2 (5fk9 C:121-233)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934376Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)
  7. 2934377Species Staphylococcus aureus [TaxId:1280] [54337] (7 PDB entries)
  8. 2934386Domain d5fk9c2: 5fk9 C:121-233 [317887]
    Other proteins in same PDB: d5fk9a1, d5fk9a2, d5fk9b1, d5fk9b2, d5fk9c1
    automated match to d1esfa2
    mutant

Details for d5fk9c2

PDB Entry: 5fk9 (more details), 3.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor
PDB Compounds: (C:) enterotoxin type a

SCOPe Domain Sequences for d5fk9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fk9c2 d.15.6.1 (C:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

SCOPe Domain Coordinates for d5fk9c2:

Click to download the PDB-style file with coordinates for d5fk9c2.
(The format of our PDB-style files is described here.)

Timeline for d5fk9c2: