Lineage for d5fk9c1 (5fk9 C:12-120)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059276Protein automated matches [226992] (2 species)
    not a true protein
  7. 2059277Species Staphylococcus aureus [TaxId:1280] [225594] (2 PDB entries)
  8. 2059280Domain d5fk9c1: 5fk9 C:12-120 [317886]
    Other proteins in same PDB: d5fk9a1, d5fk9a2, d5fk9b1, d5fk9b2, d5fk9c2
    automated match to d1esfa1
    mutant

Details for d5fk9c1

PDB Entry: 5fk9 (more details), 3.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor
PDB Compounds: (C:) enterotoxin type a

SCOPe Domain Sequences for d5fk9c1:

Sequence, based on SEQRES records: (download)

>d5fk9c1 b.40.2.2 (C:12-120) automated matches {Staphylococcus aureus [TaxId: 1280]}
lrkkselqgtalgnlkqiyyynekaktenkeshdqalqhtilfkgfftdhswyndllvdf
dskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Sequence, based on observed residues (ATOM records): (download)

>d5fk9c1 b.40.2.2 (C:12-120) automated matches {Staphylococcus aureus [TaxId: 1280]}
lrkkselqgtalgnlkqiyyynekaktenkeshdhtilfkgfftdhswyndllvdfdskd
ivdkykgkkvdlygayygyqcagpnktacmyggvtlhdnnrlt

SCOPe Domain Coordinates for d5fk9c1:

Click to download the PDB-style file with coordinates for d5fk9c1.
(The format of our PDB-style files is described here.)

Timeline for d5fk9c1: