![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins) |
![]() | Protein automated matches [190618] (1 species) not a true protein |
![]() | Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries) |
![]() | Domain d5imid_: 5imi D: [317885] Other proteins in same PDB: d5imib2 automated match to d2oa6d_ complexed with gol, jf1, mg, pop |
PDB Entry: 5imi (more details), 2.46 Å
SCOPe Domain Sequences for d5imid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5imid_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]} lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwaqttl rysvvv
Timeline for d5imid_:
![]() Domains from other chains: (mouse over for more information) d5imia_, d5imib1, d5imib2, d5imic_ |