| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5fkaa1: 5fka A:2-113 [317875] Other proteins in same PDB: d5fkaa2, d5fkac1, d5fkac2 automated match to d4eura1 complexed with zn |
PDB Entry: 5fka (more details), 2.4 Å
SCOPe Domain Sequences for d5fkaa1:
Sequence, based on SEQRES records: (download)
>d5fkaa1 b.1.1.0 (A:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrls
attvaterysllyisssqttdsgvyfcavdsatsgtykyifgtgtrlkvlan
>d5fkaa1 b.1.1.0 (A:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giqveqsppdlilqeganstlrcnfsdsvnnlqwfhqngqlinlfyipsgtkqngrlsat
tvaterysllyisssqttdsgvyfcavdsagtykyifgtgtrlkvlan
Timeline for d5fkaa1:
View in 3DDomains from other chains: (mouse over for more information) d5fkab1, d5fkab2, d5fkac1, d5fkac2 |