Lineage for d5fkaa1 (5fka A:2-113)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (27 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1392 PDB entries)
  8. 2356752Domain d5fkaa1: 5fka A:2-113 [317875]
    Other proteins in same PDB: d5fkaa2, d5fkac1, d5fkac2
    automated match to d4eura1
    complexed with zn

Details for d5fkaa1

PDB Entry: 5fka (more details), 2.4 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor
PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d5fkaa1:

Sequence, based on SEQRES records: (download)

>d5fkaa1 b.1.1.0 (A:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrls
attvaterysllyisssqttdsgvyfcavdsatsgtykyifgtgtrlkvlan

Sequence, based on observed residues (ATOM records): (download)

>d5fkaa1 b.1.1.0 (A:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giqveqsppdlilqeganstlrcnfsdsvnnlqwfhqngqlinlfyipsgtkqngrlsat
tvaterysllyisssqttdsgvyfcavdsagtykyifgtgtrlkvlan

SCOPe Domain Coordinates for d5fkaa1:

Click to download the PDB-style file with coordinates for d5fkaa1.
(The format of our PDB-style files is described here.)

Timeline for d5fkaa1: