![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 protein domains) automatically mapped to Pfam PF00574 |
![]() | Protein automated matches [190149] (9 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93061] [189958] (6 PDB entries) |
![]() | Domain d5c90d_: 5c90 D: [317869] automated match to d3qwda_ complexed with mpd; mutant |
PDB Entry: 5c90 (more details), 1.75 Å
SCOPe Domain Sequences for d5c90d_:
Sequence, based on SEQRES records: (download)
>d5c90d_ c.14.1.1 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]} liptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyl ainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmi hqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeake yglidevmvp
>d5c90d_ c.14.1.1 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]} liptaydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggsvt agfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgq ateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp
Timeline for d5c90d_: