SCOPe 2.08: Domain d5i8eb2: 5i8e B:108-210

Lineage for d5i8eb2 (5i8e B:108-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5i8eb2: 5i8e B:108-210 [317864]
   automated match to d2hmic2
   complexed with zn

Details for d5i8eb2

PDB Entry: 5i8e, 2.66 Å

PDB Description: crystal structure of broadly neutralizing hiv-1 fusion peptide- targeting antibody vrc34.01 fab

PDB Compounds: (B:) VRC34.01 Fab light chain

SCOPe Domain Sequences for d5i8eb2:

Sequence, based on SEQRES records:

>d5i8eb2 b.1.1.0 (B:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfn

Sequence, based on observed residues (ATOM records):

>d5i8eb2 b.1.1.0 (B:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvgnsqesvteqdskdsty
slsstltlskadyekhkvyacevthqglsspvtksfn

Timeline for d5i8eb2:

• d5i8eb2 first appeared in SCOPe 2.06
  
• d5i8eb2 appears in SCOPe 2.07