Lineage for d4zxta_ (4zxt A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981976Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2981977Species Human (Homo sapiens) [TaxId:9606] [56135] (74 PDB entries)
  8. 2982024Domain d4zxta_: 4zxt A: [317859]
    automated match to d3sa0a_
    complexed with caq, nh4, so4

Details for d4zxta_

PDB Entry: 4zxt (more details), 2 Å

PDB Description: complex of erk2 with catechol
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d4zxta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zxta_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}
agagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycq
rtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhi
cyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflte
yvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgs
psqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveq
alahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg

SCOPe Domain Coordinates for d4zxta_:

Click to download the PDB-style file with coordinates for d4zxta_.
(The format of our PDB-style files is described here.)

Timeline for d4zxta_: