Lineage for d5j63c1 (5j63 C:1-203)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892512Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2892613Protein automated matches [227063] (3 species)
    not a true protein
  7. 2892614Species Escherichia coli [TaxId:656414] [317790] (1 PDB entry)
  8. 2892617Domain d5j63c1: 5j63 C:1-203 [317851]
    Other proteins in same PDB: d5j63a2, d5j63b2, d5j63c2, d5j63d2
    automated match to d2blna2
    complexed with fnx, g3n

Details for d5j63c1

PDB Entry: 5j63 (more details), 2.5 Å

PDB Description: crystal structure of the n-terminal n-formyltransferase domain (residues 1-306) of escherichia coli arna in complex with udp-ara4n and folinic acid
PDB Compounds: (C:) Bifunctional polymyxin resistance protein ArnA

SCOPe Domain Sequences for d5j63c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j63c1 c.65.1.1 (C:1-203) automated matches {Escherichia coli [TaxId: 656414]}
mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
khgnileiaqreneatcfgrrtp

SCOPe Domain Coordinates for d5j63c1:

Click to download the PDB-style file with coordinates for d5j63c1.
(The format of our PDB-style files is described here.)

Timeline for d5j63c1: