![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
![]() | Superfamily c.65.1: Formyltransferase [53328] (2 families) ![]() |
![]() | Family c.65.1.1: Formyltransferase [53329] (5 proteins) |
![]() | Protein automated matches [227063] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:656414] [317790] (1 PDB entry) |
![]() | Domain d5j63c1: 5j63 C:1-203 [317851] Other proteins in same PDB: d5j63a2, d5j63b2, d5j63c2, d5j63d2 automated match to d2blna2 complexed with fnx, g3n |
PDB Entry: 5j63 (more details), 2.5 Å
SCOPe Domain Sequences for d5j63c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j63c1 c.65.1.1 (C:1-203) automated matches {Escherichia coli [TaxId: 656414]} mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai khgnileiaqreneatcfgrrtp
Timeline for d5j63c1: