Lineage for d1zpda2 (1zpd A:2-187)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69360Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 69361Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 69362Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (3 proteins)
  6. 69367Protein Pyruvate decarboxylase [52520] (3 species)
  7. 69382Species Zymomonas mobilis [TaxId:542] [52523] (1 PDB entry)
  8. 69383Domain d1zpda2: 1zpd A:2-187 [31785]
    Other proteins in same PDB: d1zpda1, d1zpdb1, d1zpde1, d1zpdf1

Details for d1zpda2

PDB Entry: 1zpd (more details), 1.86 Å

PDB Description: pyruvate decarboxylase from zymomonas mobilis

SCOP Domain Sequences for d1zpda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpda2 c.36.1.1 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis}
sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
salfnd

SCOP Domain Coordinates for d1zpda2:

Click to download the PDB-style file with coordinates for d1zpda2.
(The format of our PDB-style files is described here.)

Timeline for d1zpda2: