SCOPe 2.07: Domain d4zrvb1: 4zrv B:79-208

Lineage for d4zrvb1 (4zrv B:79-208)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (19 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [227618] (6 PDB entries)

8. Domain d4zrvb1: 4zrv B:79-208 [317849]
   Other proteins in same PDB: d4zrva2, d4zrvb2, d4zrvc2
   automated match to d4kzwa_
   complexed with 4rs, act, ca

Details for d4zrvb1

PDB Entry: 4zrv, 2.1 Å

PDB Description: structure of cow mincle crd complexed with trehalose mono butyrate

PDB Compounds: (B:) Mincle CRD

SCOPe Domain Sequences for d4zrvb1:

Sequence; same for both SEQRES and ATOM records:

>d4zrvb1 d.169.1.0 (B:79-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
cplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefyi
gltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcff
nmfrvcempe

Timeline for d4zrvb1:

• d4zrvb1 first appeared in SCOPe 2.06