Lineage for d4xbha_ (4xbh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963834Family d.92.1.4: Neutral endopeptidase (neprilysin) [55502] (2 proteins)
  6. 2963851Protein automated matches [191254] (2 species)
    not a true protein
  7. 2963855Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [317833] (3 PDB entries)
  8. 2963856Domain d4xbha_: 4xbh A: [317843]
    automated match to d1r1ha_
    complexed with nag, po4, zn

Details for d4xbha_

PDB Entry: 4xbh (more details), 2.11 Å

PDB Description: soluble rabbit neprilysin
PDB Compounds: (A:) Neprilysin

SCOPe Domain Sequences for d4xbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xbha_ d.92.1.4 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gickssdciksaarliqnmdataepctdffkyacggwlkrnvipetssrysnfdilrdel
evilkdvlqepktedivavqkaktlyrscvnetaidsrggqpllkllpdvygwpvatqnw
eqtygtswsaeksiaqlnskygkkvlinffvgtddknsmnhiihidqprlglpsrdyyec
tgiykeactayvdfmiavaklirqeeglpidenqisvemnkvmelekeianattksedrn
dpmllynkmtlaqiqnnfsleingkpfswsnftneimstvninipneedvvvyapeylik
lkpiltkysprdlqnlmswrfimdlvsslsrtykdsrnafrkalygttsesatwrrcany
vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkkaeekal
aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
witgaaivnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
rnfnkdgdlvdwwtqqsannfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
igqayrayqnyvkkngeekllpgidlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
gnfriigslqnsvefseafqcpknsymnpekkcrvw

SCOPe Domain Coordinates for d4xbha_:

Click to download the PDB-style file with coordinates for d4xbha_.
(The format of our PDB-style files is described here.)

Timeline for d4xbha_: