Lineage for d5fkac2 (5fka C:121-233)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934586Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2934587Protein automated matches [226841] (6 species)
    not a true protein
  7. 2934588Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries)
  8. 2934603Domain d5fkac2: 5fka C:121-233 [317842]
    Other proteins in same PDB: d5fkaa1, d5fkaa2, d5fkab1, d5fkab2, d5fkac1
    automated match to d1esfa2
    complexed with zn

Details for d5fkac2

PDB Entry: 5fka (more details), 2.4 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor
PDB Compounds: (C:) staphylococcal enterotoxin e

SCOPe Domain Sequences for d5fkac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fkac2 d.15.6.0 (C:121-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwidgkqttvpidkvktskkevtvqeldlqarhylhgkfglynsdsfggkvq
rglivfhssegstvsydlfdaqgqypdtllriyrdnktinsenlhidlylytt

SCOPe Domain Coordinates for d5fkac2:

Click to download the PDB-style file with coordinates for d5fkac2.
(The format of our PDB-style files is described here.)

Timeline for d5fkac2: