| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
| Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
| Protein automated matches [226841] (6 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries) |
| Domain d5fkac2: 5fka C:121-233 [317842] Other proteins in same PDB: d5fkaa1, d5fkaa2, d5fkab1, d5fkab2, d5fkac1 automated match to d1esfa2 complexed with zn |
PDB Entry: 5fka (more details), 2.4 Å
SCOPe Domain Sequences for d5fkac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fkac2 d.15.6.0 (C:121-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwidgkqttvpidkvktskkevtvqeldlqarhylhgkfglynsdsfggkvq
rglivfhssegstvsydlfdaqgqypdtllriyrdnktinsenlhidlylytt
Timeline for d5fkac2:
View in 3DDomains from other chains: (mouse over for more information) d5fkaa1, d5fkaa2, d5fkab1, d5fkab2 |