SCOPe 2.07: Domain d5fkac2: 5fka C:121-233

Lineage for d5fkac2 (5fka C:121-233)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225055] (8 PDB entries)

8. Domain d5fkac2: 5fka C:121-233 [317842]
   Other proteins in same PDB: d5fkaa1, d5fkaa2, d5fkab1, d5fkab2, d5fkac1
   automated match to d1esfa2
   complexed with zn

Details for d5fkac2

PDB Entry: 5fka, 2.4 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor

PDB Compounds: (C:) staphylococcal enterotoxin e

SCOPe Domain Sequences for d5fkac2:

Sequence; same for both SEQRES and ATOM records:

>d5fkac2 d.15.6.0 (C:121-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwidgkqttvpidkvktskkevtvqeldlqarhylhgkfglynsdsfggkvq
rglivfhssegstvsydlfdaqgqypdtllriyrdnktinsenlhidlylytt

Timeline for d5fkac2:

• d5fkac2 first appeared in SCOPe 2.06