![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (22 species) not a true protein |
![]() | Species Hypericum kouytchense [TaxId:269000] [317838] (1 PDB entry) |
![]() | Domain d5i8fa1: 5i8f A:1-159 [317839] Other proteins in same PDB: d5i8fa2 automated match to d1e09a_ complexed with gol, ml1, na, unl |
PDB Entry: 5i8f (more details), 1.3 Å
SCOPe Domain Sequences for d5i8fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i8fa1 d.129.3.0 (A:1-159) automated matches {Hypericum kouytchense [TaxId: 269000]} maaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvtkitfv dghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgkitvty hpkpgctvneeevkigekkayefykqveeylaanpevfa
Timeline for d5i8fa1: