SCOPe 2.06: Domain d5i8fa1: 5i8f A:1-159

Lineage for d5i8fa1 (5i8f A:1-159)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Hypericum kouytchense [TaxId:269000] [317838] (1 PDB entry)

8. Domain d5i8fa1: 5i8f A:1-159 [317839]
   Other proteins in same PDB: d5i8fa2
   automated match to d1e09a_
   complexed with gol, ml1, na, unl

Details for d5i8fa1

PDB Entry: 5i8f, 1.3 Å

PDB Description: crystal structure of st. john's wort hyp-1 protein in complex with melatonin

PDB Compounds: (A:) Phenolic oxidative coupling protein

SCOPe Domain Sequences for d5i8fa1:

Sequence; same for both SEQRES and ATOM records:

>d5i8fa1 d.129.3.0 (A:1-159) automated matches {Hypericum kouytchense [TaxId: 269000]}
maaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvtkitfv
dghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgkitvty
hpkpgctvneeevkigekkayefykqveeylaanpevfa

Timeline for d5i8fa1:

• d5i8fa1 is new in SCOPe 2.06-stable
  
• d5i8fa1 appears in SCOPe 2.07
  
• d5i8fa1 appears in the current release, SCOPe 2.08