Lineage for d4yqeb_ (4yqe B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439108Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2439576Family c.23.5.8: WrbA-like [117474] (3 protein domains)
  6. 2439585Protein Trp repressor binding protein WrbA [117475] (4 species)
  7. 2439610Species Escherichia coli [TaxId:83333] [317703] (2 PDB entries)
  8. 2439612Domain d4yqeb_: 4yqe B: [317831]
    automated match to d2rg1b_
    complexed with fmn, plq

Details for d4yqeb_

PDB Entry: 4yqe (more details), 1.33 Å

PDB Description: crystal structure of e. coli wrba in complex with benzoquinone
PDB Compounds: (B:) NAD(P)H dehydrogenase (quinone)

SCOPe Domain Sequences for d4yqeb_:

Sequence, based on SEQRES records: (download)

>d4yqeb_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

Sequence, based on observed residues (ATOM records): (download)

>d4yqeb_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqgtpygattiaggdgsrqpsqeelsiary
qgeyvaglavklng

SCOPe Domain Coordinates for d4yqeb_:

Click to download the PDB-style file with coordinates for d4yqeb_.
(The format of our PDB-style files is described here.)

Timeline for d4yqeb_: