Lineage for d1qpbb2 (1qpb B:2-181)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1844143Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1844144Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1844145Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 1844251Protein Pyruvate decarboxylase [88725] (3 species)
  7. 1844252Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88727] (2 PDB entries)
  8. 1844256Domain d1qpbb2: 1qpb B:2-181 [31783]
    Other proteins in same PDB: d1qpba1, d1qpba3, d1qpbb1, d1qpbb3
    complexed with mg, pym, tpp

Details for d1qpbb2

PDB Entry: 1qpb (more details), 2.4 Å

PDB Description: pyruvate decarboyxlase from yeast (form b) complexed with pyruvamide
PDB Compounds: (B:) pyruvate decarboxylase (form b)

SCOPe Domain Sequences for d1qpbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpbb2 c.36.1.5 (B:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgngd
ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

SCOPe Domain Coordinates for d1qpbb2:

Click to download the PDB-style file with coordinates for d1qpbb2.
(The format of our PDB-style files is described here.)

Timeline for d1qpbb2: