![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.8: WrbA-like [117474] (3 proteins) |
![]() | Protein Trp repressor binding protein WrbA [117475] (4 species) |
![]() | Species Escherichia coli [TaxId:83333] [317703] (2 PDB entries) |
![]() | Domain d4yqea_: 4yqe A: [317829] automated match to d2rg1b_ complexed with fmn, plq |
PDB Entry: 4yqe (more details), 1.33 Å
SCOPe Domain Sequences for d4yqea_:
Sequence, based on SEQRES records: (download)
>d4yqea_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 83333]} akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi aryqgeyvaglavklng
>d4yqea_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 83333]} akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe qtitstwttlahhgmvivpigyaggtpygattiaggdgsrqpsqeelsiaryqgeyvagl avklng
Timeline for d4yqea_: