Lineage for d4yqea_ (4yqe A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856848Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 2856857Protein Trp repressor binding protein WrbA [117475] (4 species)
  7. 2856882Species Escherichia coli [TaxId:83333] [317703] (2 PDB entries)
  8. 2856883Domain d4yqea_: 4yqe A: [317829]
    automated match to d2rg1b_
    complexed with fmn, plq

Details for d4yqea_

PDB Entry: 4yqe (more details), 1.33 Å

PDB Description: crystal structure of e. coli wrba in complex with benzoquinone
PDB Compounds: (A:) NAD(P)H dehydrogenase (quinone)

SCOPe Domain Sequences for d4yqea_:

Sequence, based on SEQRES records: (download)

>d4yqea_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

Sequence, based on observed residues (ATOM records): (download)

>d4yqea_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaggtpygattiaggdgsrqpsqeelsiaryqgeyvagl
avklng

SCOPe Domain Coordinates for d4yqea_:

Click to download the PDB-style file with coordinates for d4yqea_.
(The format of our PDB-style files is described here.)

Timeline for d4yqea_: