Lineage for d1qpba3 (1qpb A:361-556)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22854Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 22855Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 22856Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (3 proteins)
  6. 22861Protein Pyruvate decarboxylase [52520] (3 species)
  7. 22862Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52522] (2 PDB entries)
  8. 22868Domain d1qpba3: 1qpb A:361-556 [31782]
    Other proteins in same PDB: d1qpba1, d1qpbb1

Details for d1qpba3

PDB Entry: 1qpb (more details), 2.4 Å

PDB Description: pyruvate decarboyxlase from yeast (form b) complexed with pyruvamide

SCOP Domain Sequences for d1qpba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpba3 c.36.1.1 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae)}
astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmievml
pvfdapqnlveqaklt

SCOP Domain Coordinates for d1qpba3:

Click to download the PDB-style file with coordinates for d1qpba3.
(The format of our PDB-style files is described here.)

Timeline for d1qpba3: