SCOP 1.57: Domain d1qpba2: 1qpb A:2-181

Lineage for d1qpba2 (1qpb A:2-181)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families)

5. Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (3 proteins)

6. Protein Pyruvate decarboxylase [52520] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52522] (2 PDB entries)

8. Domain d1qpba2: 1qpb A:2-181 [31781]
   Other proteins in same PDB: d1qpba1, d1qpbb1

Details for d1qpba2

PDB Entry: 1qpb, 2.4 Å

PDB Description: pyruvate decarboyxlase from yeast (form b) complexed with pyruvamide

SCOP Domain Sequences for d1qpba2:

Sequence; same for both SEQRES and ATOM records:

>d1qpba2 c.36.1.1 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae)}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgngd
ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

Timeline for d1qpba2:

• d1qpba2 first appeared (with stable ids) in SCOP 1.55
  
• d1qpba2 appears in SCOP 1.59
  
• d1qpba2 appears in the current release, SCOPe 2.08