SCOPe 2.08: Domain d5jmta1: 5jmt A:175-481

Lineage for d5jmta1 (5jmt A:175-481)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein automated matches [226986] (8 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317808] (28 PDB entries)

8. Domain d5jmta1: 5jmt A:175-481 [317809]
   Other proteins in same PDB: d5jmta2
   automated match to d2bhra2

Details for d5jmta1

PDB Entry: 5jmt, 1.8 Å

PDB Description: crystal structure of zika virus ns3 helicase

PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5jmta1:

Sequence; same for both SEQRES and ATOM records:

>d5jmta1 c.37.1.14 (A:175-481) automated matches {Zika virus [TaxId: 64320]}
pvecfepsmlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaemee
alrglpvrymttavnvthsgteivdlmchatftsrllqpirvpnynlyimdeahftdpss
iaargyistrvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtd
hsgktvwfvpsvrngneiaacltkagkrviqlsrktfetefqktkhqewdfvvttdisem
ganfkadrvidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeylyg
ggcaetd

Timeline for d5jmta1:

• d5jmta1 first appeared in SCOPe 2.06
  
• d5jmta1 appears in SCOPe 2.07