Lineage for d5jbna1 (5jbn A:2-159)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442769Family c.26.1.3: Adenylyltransferase [52397] (6 protein domains)
  6. 2442926Protein automated matches [190964] (6 species)
    not a true protein
  7. 2442946Species Escherichia coli [TaxId:83333] [317802] (7 PDB entries)
  8. 2442947Domain d5jbna1: 5jbn A:2-159 [317804]
    Other proteins in same PDB: d5jbna2
    automated match to d1gn8a_
    complexed with dms, so4

Details for d5jbna1

PDB Entry: 5jbn (more details), 1.45 Å

PDB Description: crystal structure of apo phosphopantetheine adenylyltransferase (ppat/coad) from e. coli
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5jbna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jbna1 c.26.1.3 (A:2-159) automated matches {Escherichia coli [TaxId: 83333]}
qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
kewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d5jbna1:

Click to download the PDB-style file with coordinates for d5jbna1.
(The format of our PDB-style files is described here.)

Timeline for d5jbna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jbna2
View in 3D
Domains from other chains:
(mouse over for more information)
d5jbnb_