Lineage for d1pvdb3 (1pvd B:361-556)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121562Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 121563Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 121564Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (4 proteins)
  6. 121575Protein Pyruvate decarboxylase [52520] (3 species)
  7. 121576Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52522] (2 PDB entries)
  8. 121580Domain d1pvdb3: 1pvd B:361-556 [31780]
    Other proteins in same PDB: d1pvda1, d1pvdb1

Details for d1pvdb3

PDB Entry: 1pvd (more details), 2.3 Å

PDB Description: crystal structure of the thiamin diphosphate dependent enzyme pyruvate decarboxylase from the yeast saccharomyces cerevisiae at 2.3 angstroms resolution

SCOP Domain Sequences for d1pvdb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvdb3 c.36.1.1 (B:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae)}
astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieiml
pvfdapqnlvkqaklt

SCOP Domain Coordinates for d1pvdb3:

Click to download the PDB-style file with coordinates for d1pvdb3.
(The format of our PDB-style files is described here.)

Timeline for d1pvdb3: