| Class b: All beta proteins [48724] (180 folds) |
| Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) ![]() |
| Family b.46.1.0: automated matches [227262] (1 protein) not a true family |
| Protein automated matches [227053] (7 species) not a true protein |
| Species Escherichia coli [TaxId:656414] [317792] (1 PDB entry) |
| Domain d5j63b2: 5j63 B:204-305 [317796] Other proteins in same PDB: d5j63a1, d5j63b1, d5j63c1, d5j63d1 automated match to d2blna1 complexed with fnx, g3n |
PDB Entry: 5j63 (more details), 2.5 Å
SCOPe Domain Sequences for d5j63b2:
Sequence, based on SEQRES records: (download)
>d5j63b2 b.46.1.0 (B:204-305) automated matches {Escherichia coli [TaxId: 656414]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvisva
plliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrln
>d5j63b2 b.46.1.0 (B:204-305) automated matches {Escherichia coli [TaxId: 656414]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhpaqpgsvisvaplli
acgdgaleivtgqagdgitmqgsqlaqtlglvqgsrln
Timeline for d5j63b2: