SCOPe 2.08: Domain d5j63b1: 5j63 B:1-203

Lineage for d5j63b1 (5j63 B:1-203)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (5 proteins)

6. Protein automated matches [227063] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:656414] [317790] (1 PDB entry)

8. Domain d5j63b1: 5j63 B:1-203 [317795]
   Other proteins in same PDB: d5j63a2, d5j63b2, d5j63c2, d5j63d2
   automated match to d2blna2
   complexed with fnx, g3n

Details for d5j63b1

PDB Entry: 5j63, 2.5 Å

PDB Description: crystal structure of the n-terminal n-formyltransferase domain (residues 1-306) of escherichia coli arna in complex with udp-ara4n and folinic acid

PDB Compounds: (B:) Bifunctional polymyxin resistance protein ArnA

SCOPe Domain Sequences for d5j63b1:

Sequence; same for both SEQRES and ATOM records:

>d5j63b1 c.65.1.1 (B:1-203) automated matches {Escherichia coli [TaxId: 656414]}
mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
khgnileiaqreneatcfgrrtp

Timeline for d5j63b1:

• d5j63b1 first appeared in SCOPe 2.06
  
• d5j63b1 appears in SCOPe 2.07