Lineage for d5j63d2 (5j63 D:204-306)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794501Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2794502Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2794549Family b.46.1.0: automated matches [227262] (1 protein)
    not a true family
  6. 2794550Protein automated matches [227053] (7 species)
    not a true protein
  7. 2794562Species Escherichia coli [TaxId:656414] [317792] (1 PDB entry)
  8. 2794566Domain d5j63d2: 5j63 D:204-306 [317793]
    Other proteins in same PDB: d5j63a1, d5j63b1, d5j63c1, d5j63d1
    automated match to d2blna1
    complexed with fnx, g3n

Details for d5j63d2

PDB Entry: 5j63 (more details), 2.5 Å

PDB Description: crystal structure of the n-terminal n-formyltransferase domain (residues 1-306) of escherichia coli arna in complex with udp-ara4n and folinic acid
PDB Compounds: (D:) Bifunctional polymyxin resistance protein ArnA

SCOPe Domain Sequences for d5j63d2:

Sequence, based on SEQRES records: (download)

>d5j63d2 b.46.1.0 (D:204-306) automated matches {Escherichia coli [TaxId: 656414]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvisva
plliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrlns

Sequence, based on observed residues (ATOM records): (download)

>d5j63d2 b.46.1.0 (D:204-306) automated matches {Escherichia coli [TaxId: 656414]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhpqpgsvisvapllia
cgdgaleivtgqagdgitmqgsqlaqtlglvqgsrlns

SCOPe Domain Coordinates for d5j63d2:

Click to download the PDB-style file with coordinates for d5j63d2.
(The format of our PDB-style files is described here.)

Timeline for d5j63d2: