Lineage for d1pvdb2 (1pvd B:2-181)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179051Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 179052Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 179053Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (4 proteins)
  6. 179064Protein Pyruvate decarboxylase [52520] (3 species)
  7. 179065Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52522] (2 PDB entries)
  8. 179068Domain d1pvdb2: 1pvd B:2-181 [31779]
    Other proteins in same PDB: d1pvda1, d1pvdb1

Details for d1pvdb2

PDB Entry: 1pvd (more details), 2.3 Å

PDB Description: crystal structure of the thiamin diphosphate dependent enzyme pyruvate decarboxylase from the yeast saccharomyces cerevisiae at 2.3 angstroms resolution

SCOP Domain Sequences for d1pvdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvdb2 c.36.1.1 (B:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae)}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

SCOP Domain Coordinates for d1pvdb2:

Click to download the PDB-style file with coordinates for d1pvdb2.
(The format of our PDB-style files is described here.)

Timeline for d1pvdb2: