SCOPe 2.06: Domain d5hlnb_: 5hln B:

Lineage for d5hlnb_ (5hln B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
   CMGC group; GSK3 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [69824] (43 PDB entries)
   Uniprot P49841 35-383 ! Uniprot P49841 35-384

8. Domain d5hlnb_: 5hln B: [317787]
   automated match to d1j1bb_
   complexed with 65c, mes, mg

Details for d5hlnb_

PDB Entry: 5hln, 3.1 Å

PDB Description: x-ray crystal structure of gsk3b in complex with chir99021

PDB Compounds: (B:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d5hlnb_:

Sequence; same for both SEQRES and ATOM records:

>d5hlnb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
vttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknr
elqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpvi
yvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsy
icsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtp
treqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleaca
hsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar

Timeline for d5hlnb_:

• d5hlnb_ is new in SCOPe 2.06-stable
  
• d5hlnb_ appears in SCOPe 2.07
  
• d5hlnb_ appears in the current release, SCOPe 2.08