SCOPe 2.06: Domain d5fk9b1: 5fk9 B:2-114

Lineage for d5fk9b1 (5fk9 B:2-114)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5fk9b1: 5fk9 B:2-114 [317785]
   Other proteins in same PDB: d5fk9a2, d5fk9c1, d5fk9c2
   automated match to d3q5ya1
   mutant

Details for d5fk9b1

PDB Entry: 5fk9, 3.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor

PDB Compounds: (B:) T cell receptor beta chain

SCOPe Domain Sequences for d5fk9b1:

Sequence; same for both SEQRES and ATOM records:

>d5fk9b1 b.1.1.0 (B:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dtgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrl
lsdrfsaerpkgsfstleiqrteqgdsamylcasslggyeqyfgpgtrltvte

Timeline for d5fk9b1:

• d5fk9b1 is new in SCOPe 2.06-stable
  
• d5fk9b1 appears in SCOPe 2.07
  
• d5fk9b1 appears in the current release, SCOPe 2.08