Lineage for d5ivgd_ (5ivg D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014631Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)
  6. 2014646Protein automated matches [190618] (1 species)
    not a true protein
  7. 2014647Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)
  8. 2014691Domain d5ivgd_: 5ivg D: [317780]
    automated match to d2oa6d_
    complexed with fps, gol, mg

Details for d5ivgd_

PDB Entry: 5ivg (more details), 1.95 Å

PDB Description: crystal structure of aspergillus terreus aristolochene synthase n299a complexed with farnesyl thiolodiphosphate
PDB Compounds: (D:) Aristolochene synthase

SCOPe Domain Sequences for d5ivgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ivgd_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgaelwsqttl
rysvv

SCOPe Domain Coordinates for d5ivgd_:

Click to download the PDB-style file with coordinates for d5ivgd_.
(The format of our PDB-style files is described here.)

Timeline for d5ivgd_: