SCOPe 2.06: Domain d5ivgb_: 5ivg B:

Lineage for d5ivgb_ (5ivg B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)

6. Protein automated matches [190618] (1 species)
   not a true protein

7. Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)

8. Domain d5ivgb_: 5ivg B: [317778]
   automated match to d2oa6d_
   complexed with fps, gol, mg

Details for d5ivgb_

PDB Entry: 5ivg, 1.95 Å

PDB Description: crystal structure of aspergillus terreus aristolochene synthase n299a complexed with farnesyl thiolodiphosphate

PDB Compounds: (B:) Aristolochene synthase

SCOPe Domain Sequences for d5ivgb_:

Sequence; same for both SEQRES and ATOM records:

>d5ivgb_ a.128.1.4 (B:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgaelwsqttl
rysv

Timeline for d5ivgb_:

• d5ivgb_ is new in SCOPe 2.06-stable
  
• d5ivgb_ appears in SCOPe 2.07
  
• d5ivgb_ appears in the current release, SCOPe 2.08