| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
| Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins) |
| Protein automated matches [190618] (1 species) not a true protein |
| Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries) |
| Domain d5imia_: 5imi A: [317774] Other proteins in same PDB: d5imib2 automated match to d2oa6d_ complexed with gol, jf1, mg, pop |
PDB Entry: 5imi (more details), 2.46 Å
SCOPe Domain Sequences for d5imia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5imia_ a.128.1.4 (A:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwaqttl
rysvvv
Timeline for d5imia_:
View in 3DDomains from other chains: (mouse over for more information) d5imib1, d5imib2, d5imic_, d5imid_ |