| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
| Protein Pyruvate decarboxylase [88725] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88727] (2 PDB entries) |
| Domain d1pvda2: 1pvd A:2-181 [31777] Other proteins in same PDB: d1pvda1, d1pvda3, d1pvdb1, d1pvdb3 complexed with mg, tpp |
PDB Entry: 1pvd (more details), 2.3 Å
SCOPe Domain Sequences for d1pvda2:
Sequence, based on SEQRES records: (download)
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgngd
ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
Timeline for d1pvda2: