SCOPe 2.06: Domain d5imnd_: 5imn D:

Lineage for d5imnd_ (5imn D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)

6. Protein automated matches [190618] (1 species)
   not a true protein

7. Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)

8. Domain d5imnd_: 5imn D: [317768]
   automated match to d2oa6d_
   complexed with gol, jf1, mg, pop

Details for d5imnd_

PDB Entry: 5imn, 2.53 Å

PDB Description: crystal structure of n299a/s303a aspergillus terreus aristolochene synthase complexed with (1s,8s,9ar)-1,9a-dimethyl-8-(prop-1-en-2-yl) decahydroquinolizin-5-ium

PDB Compounds: (D:) Aristolochene synthase

SCOPe Domain Sequences for d5imnd_:

Sequence; same for both SEQRES and ATOM records:

>d5imnd_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgaelwaqttl
rysv

Timeline for d5imnd_:

• d5imnd_ is new in SCOPe 2.06-stable
  
• d5imnd_ appears in SCOPe 2.07
  
• d5imnd_ appears in the current release, SCOPe 2.08